Total number of results for Hystrix cristata are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02673 |
FVNQHLCGSHLVEALYLVCGNDGFFYRPKA
|
30 | Hystrix cristata | Insulin | Insulin B chain | 6995860#Horuk R., Blundell T.L., Lazarus N.R., Neville R.W.J., Stone D., Wollmer A.#A monomeric insulin from the porcupine (Hystrix cristata), an Old World hystricomorph.# Nature 286:822-824(1980). | |
| NP02674 |
GIVDQCCTGVCSLYQLQNYCN
|
21 | Hystrix cristata | Insulin | Insulin A chain | 6995860#Horuk R., Blundell T.L., Lazarus N.R., Neville R.W.J., Stone D., Wollmer A.#A monomeric insulin from the porcupine (Hystrix cristata), an Old World hystricomorph.# Nature 286:822-824(1980). |